PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G1621
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 261aa    MW: 31213.9 Da    PI: 6.9667
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G1621genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.52.1e-24687186
     trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86
                 +W ++e+++Li +r e+e+++ ++k +k+lWe vs++m++rg++r+p qCk+kw+nl +ryk  ++++ ++      ++p+f++l+
  Gh_D08G1621  6 QWGQEETRELIFIRGELERDFTAAKHNKTLWEIVSARMKDRGYTRTPDQCKSKWKNLLNRYKGKETSDPEN----GCQFPFFEELH 87
                 7**************************************************************99999985....44689***998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.258163IPR017877Myb-like domain
SMARTSM007172.1E-4365IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-5465IPR009057Homeodomain-like
SuperFamilySSF466894.0E-5688IPR009057Homeodomain-like
PfamPF138378.4E-22688No hitNo description
CDDcd122033.48E-22670No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MLGSGQWGQE ETRELIFIRG ELERDFTAAK HNKTLWEIVS ARMKDRGYTR TPDQCKSKWK  60
NLLNRYKGKE TSDPENGCQF PFFEELHAVF TERAKTMQRR LLEPEAGSGS TQAKKKVKRT  120
TTERSSDEFS EGEDEDESEE EKPARGISHK RKKSDSTVLD KSPRPNSGTS TGLQEMLREF  180
FDQQLRMEVQ WREMMEKRAQ ERQLFEQEWQ HWMEKLERER LMVEKAWRER EEEMRRREES  240
RAERRDSLLT TLLNKLINDN N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A3e-15785786DNA binding protein GT-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.171520.0boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6517840.0EF651784.1 Gossypium hirsutum transcription factor TF2 (TF2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475490.10.0PREDICTED: trihelix transcription factor GT-3b-like
TrEMBLA0A0D2S1D80.0A0A0D2S1D8_G
STRINGGLYMA01G35370.21e-101(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17512910
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.12e-39Trihelix family protein